Download free Farewell Angelina Sample font - Free fonts download
(0 vote)
Download free Farewell Angelina Sample font by Free fonts download free for Personal Use. Font list styles: farewell_angelina_display_sample.otf, farewell_angelina_display_sample.ttf,
Farewell, Angelina is an elegant serif font family with a feminine flair. It includes:
- a display font with 3 weights: regular, bold and black, which look great at large sizes
- a text font in 2 styles: regular and italic, which look great at small sizes and in longer texts
Each font includes:
- A-Z, a-z, 0-9
- accents
- punctuation and symbols
- ligatures
-stylistic alternates
Farewell, Angelina is perfect for magazine layouts, creating logotypes, social media posts, branding and packaging.
Try it out for free (for personal use) with this sample version!
For the full commercial version, please visit one of these links:
https://www.anasfonts.com/
https://creativemarket.com/justlikethistrain?u=justlikethistrain
https://thehungryjpeg.com/anas-fonts/
https://www.fontspring.com/foundry/anas-fonts
- a display font with 3 weights: regular, bold and black, which look great at large sizes
- a text font in 2 styles: regular and italic, which look great at small sizes and in longer texts
Each font includes:
- A-Z, a-z, 0-9
- accents
- punctuation and symbols
- ligatures
-stylistic alternates
Farewell, Angelina is perfect for magazine layouts, creating logotypes, social media posts, branding and packaging.
Try it out for free (for personal use) with this sample version!
For the full commercial version, please visit one of these links:
https://www.anasfonts.com/
https://creativemarket.com/justlikethistrain?u=justlikethistrain
https://thehungryjpeg.com/anas-fonts/
https://www.fontspring.com/foundry/anas-fonts
Please donate paypal account: [email protected]
Download font
Free for Personal Use
This fonts are authors' property, and are either shareware, demo versions or public domain. The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt. If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
- Farewell Angelina Sample farewell_angelina_display_sample.otf
Farewell Angelina Sample | farewell_angelina_display_sample.otf
- Font family: Farewell Angelina Sample
- Font subfamily identification: Regular
- Unique identifier: AnaParracho: Farewell Angelina Sample: 2018
- Full font name: Farewell Angelina Sample
- Version: Version 1. 000 2018 initial release
- Postscript font name: FarewellAngelinaSample
- Trademark notice: Farewell Angelina Sample is a trademark of Ana Parracho.
- Manufacturer name: Ana Parracho
- Designer: Ana Parracho
- Description: Copyright c 2018 by Ana Parracho. All rights reserved.
- License: Sample for personal use only.
Farewell Angelina Sample | farewell_angelina_display_sample.ttf
- Font family: Farewell Angelina Sample
- Font subfamily identification: Regular
- Unique identifier: AnaParracho: Farewell Angelina Sample: 2018
- Full font name: Farewell Angelina Sample
- Version: Version 1. 000 2018 initial release
- Postscript font name: FarewellAngelinaSample
- Trademark notice: Farewell Angelina Sample is a trademark of Ana Parracho.
- Manufacturer name: Ana Parracho
- Designer: Ana Parracho
- Description: Copyright c 2018 by Ana Parracho. All rights reserved.
- License: Sample for personal use only.
#farewell#angelina#sample#font#farewell angelina#angelina sample#sample font#farewell angelina sample#angelina sample font#farewell angelina sample font#farewellangelinadisplaysample-otf#regular#farewell-angelina-sample#basic#sans serif#farewellangelinadisplaysample#farewell angelina sample regular#farewellangelinadisplaysample-ttf#farewell angelina display sampleotf#display#sampleotf#angelina display#display sampleotf#farewell angelina display#angelina display sampleotf#farewellangelinasample#ana#parracho#ana parracho#farewell angelina display samplettf#samplettf#display samplettf#angelina display samplettf#basic fonts
